PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G115600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 262aa    MW: 28019.8 Da    PI: 4.7357
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G115600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-162572148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l   ++ +G  tW+++a+  g++R++k+c++rw +yl
  Sevir.5G115600.1.p 25 KGLWSPEEDERLFAQITYHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 72
                        678*******************************************97 PP

2Myb_DNA-binding44.82.8e-1480121346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         + ++ E+e+++ + + lG++ W++Ia++m+ gRt++++k++w++
  Sevir.5G115600.1.p  80 PISKREEEIIISLQRSLGNR-WSAIAARMP-GRTDNEIKNYWNS 121
                         56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5352072IPR017930Myb domain
SuperFamilySSF466891.42E-2724119IPR009057Homeodomain-like
SMARTSM007179.1E-112474IPR001005SANT/Myb domain
PfamPF002492.2E-132572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-212679IPR009057Homeodomain-like
CDDcd001673.19E-92872No hitNo description
PROSITE profilePS5129422.1773127IPR017930Myb domain
SMARTSM007171.3E-1377125IPR001005SANT/Myb domain
CDDcd001677.31E-1180120No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2380127IPR009057Homeodomain-like
PfamPF002492.5E-1280121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MVRKPSHGDT AGAGNGGTEA TKERKGLWSP EEDERLFAQI TYHGVSTWSS VAQLAGLRRS  60
GKSCRLRWMN YLRPDLKKEP ISKREEEIII SLQRSLGNRW SAIAARMPGR TDNEIKNYWN  120
SRIRKRLNAA AKSGGGGGDG GSSSSTEPAA PAAEEKAEAE LTNAATEAAP LPIPARFPMF  180
ACQVLDGAGD GGSESTPSST TSTQQNSGDE SEASVGDSDT IHFLSFDDLD YPADFLVDVP  240
GAMDAWESEL YPANPMSSSL Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-252512727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715591e-143EU971559.1 Zea mays clone 367166 anthocyanin regulatory C1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968332.11e-164PREDICTED: transcription factor MYB82-like
TrEMBLK3XL221e-164K3XL22_SETIT; Uncharacterized protein
STRINGSi002595m1e-164(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-47myb domain protein 86